3.18 Rating by CuteStat

falcondisplaysystems.com is 7 years 10 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, falcondisplaysystems.com is SAFE to browse.

PageSpeed Score
91
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

103.24.200.143

Hosted Country:

India IN

Location Latitude:

21.9974

Location Longitude:

79.0011

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 103.24.200.143)

web designing company Hyderabad, web designing in Hyderabad ,web desig

- outlinedesigns.in

web Design Company Hyderabad , Affordable Web site designer, web application development and Solutions company, website developers, Web Designing Company Hyderabad, web designing in Hyderabad ,Vijayawada, web design services Hyderabad, website design services Hyderabad

Not Applicable $ 8.95

.:: Immigration Assistance|Infrastructure|Project Management|Applicati

- eforcesol.com

Immigration Assistance,Infrastructure,Project Management,Application Development,ERP,CRM,Engineering Services,QA Testing,eForce Solutions

Not Applicable $ 8.95


.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.

- srisubrahmanyaswamydevalayamskandagiri.org
1,706,079 $ 720.00

Medinova, Kolkata: serology, endocrinology, ultrasound investigations

- medinovaindia.com

Medinova Diagnostics: aematology, micro-biology, histopathology, serology, endocrinology, ultrasound investigations imaging systems, colour dopplers, ECG Machines, cardiac stress system, blood test, CT scan, MRI Scan. lab, radiology, imageology, cardiology gastroscopy, aematology, micro-biology, histopathology, serolog

5,159,456 $ 240.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sun, 17 Sep 2017 00:35:49 GMT
Server: Apache
Transfer-Encoding: chunked
Content-Type: text/html

Domain Information

Domain Registrar: DropCatch.com 1315 LLC
Registration Date: May 17, 2016, 12:00 AM 7 years 10 months 4 weeks ago
Last Modified: May 21, 2016, 12:00 AM 7 years 10 months 3 weeks ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns1.lazybulls.com 103.24.200.143 India India
ns2.lazybulls.com 103.24.202.176 India India

DNS Record Analysis

Host Type TTL Extra
falcondisplaysystems.com A 14394 IP: 103.24.200.143
falcondisplaysystems.com NS 86399 Target: ns2.lazybulls.com
falcondisplaysystems.com NS 86399 Target: ns1.lazybulls.com
falcondisplaysystems.com SOA 86399 MNAME: ns1.lazybulls.com
RNAME: cpalerts.ibeesolutions.com
Serial: 2016091300
Refresh: 3600
Retry: 7200
Expire: 1209600
Minimum TTL: 86400
falcondisplaysystems.com MX 14399 Target: falcondisplaysystems.com

Full WHOIS Lookup

Domain Name: FALCONDISPLAYSYSTEMS.COM
Registry Domain ID: 2028876874_DOMAIN_COM-VRSN
Registrar WHOIS Server: Whois.bigrock.com
Registrar URL: http://www.bigrock.com
Updated Date: 2016-05-21T07:05:20Z
Creation Date: 2016-05-17T09:42:42Z
Registry Expiry Date: 2021-05-17T09:42:42Z
Registrar: BigRock Solutions Limited
Registrar IANA ID: 1495
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1.2013775952
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.LAZYBULLS.COM
Name Server: NS2.LAZYBULLS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-09-17T00:35:40Z